Lineage for d2byja1 (2byj A:36-439)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896011Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2896169Protein Ornithine aminotransferase [53422] (3 species)
  7. 2896170Species Human (Homo sapiens) [TaxId:9606] [53423] (11 PDB entries)
  8. 2896201Domain d2byja1: 2byj A:36-439 [129483]
    Other proteins in same PDB: d2byjb_, d2byjc_
    complexed with plp; mutant

Details for d2byja1

PDB Entry: 2byj (more details), 3.02 Å

PDB Description: ornithine aminotransferase mutant y85i
PDB Compounds: (A:) ornithine aminotransferase

SCOPe Domain Sequences for d2byja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2byja1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]}
gpptsddifereykygahnyhplpvalergkgiylwdvegrkyfdflssisavnqghchp
kivnalksqvdkltltsrafynnvlgeyeeyitklfnyhkvlpmntgveagetacklark
wgytvkgiqkykakivfaagnfwgrtlsaissstdptsydgfgpfmpgfdiipyndlpal
eralqdpnvaafmvepiqgeagvvvpdpgylmgvrelctrhqvlfiadeiqtglartgrw
lavdyenvrpdivllgkalsgglypvsavlcdddimltikpgehgstyggnplgcrvaia
alevleeenlaenadklgiilrnelmklpsdvvtavrgkgllnaiviketkdwdawkvcl
rlrdngllakpthgdiirfapplvikedelresieiinktilsf

SCOPe Domain Coordinates for d2byja1:

Click to download the PDB-style file with coordinates for d2byja1.
(The format of our PDB-style files is described here.)

Timeline for d2byja1: