SCOPe 2.04: Domain d2bx7a_: 2bx7 A:

Lineage for d2bx7a_ (2bx7 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)

6. Protein automated matches [190228] (14 species)
   not a true protein

7. Species Lactococcus lactis [TaxId:1358] [186992] (2 PDB entries)

8. Domain d2bx7a_: 2bx7 A: [129395]
   automated match to d1dora_
   complexed with 34d, act, fmn, gol, mg

Details for d2bx7a_

PDB Entry: 2bx7, 2.04 Å

PDB Description: crystal structure of l. lactis dihydroorotate dehydrogense a in complex with 3,5-dihydroxybenzoate

PDB Compounds: (A:) dihydroorotate dehydrogenase

SCOPe Domain Sequences for d2bx7a_:

Sequence; same for both SEQRES and ATOM records:

>d2bx7a_ c.1.4.1 (A:) automated matches {Lactococcus lactis [TaxId: 1358]}
mlnttfanakfanpfmnasgvhcmtiedleelkasqagayitksstlekregnplpryvd
lelgsinsmglpnlgfdyyldyvlknqkenaqegpiffsiagmsaaeniamlkkiqesdf
sgitelnlscpnvpgkpqlaydfeatekllkevftfftkplgvklppyfdlvhfdimaei
lnqfpltyvnsvnsignglfidpeaesvvikpkdgfggiggayikptalanvrafytrlk
peiqiigtggietgqdafehllcgatmlqigtalhkegpaifdriikeleeimnqkgyqs
iadfhgklksl

Timeline for d2bx7a_:

• d2bx7a_ first appeared in SCOP 1.73, called d2bx7a1
  
• d2bx7a_ appears in SCOPe 2.03
  
• d2bx7a_ appears in SCOPe 2.05
  
• d2bx7a_ appears in the current release, SCOPe 2.08