Lineage for d2bx7a_ (2bx7 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1338072Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 1338073Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 1338358Protein automated matches [190228] (10 species)
    not a true protein
  7. 1338367Species Lactococcus lactis [TaxId:1358] [186992] (2 PDB entries)
  8. 1338368Domain d2bx7a_: 2bx7 A: [129395]
    automated match to d1dora_
    complexed with 34d, act, fmn, gol, mg

Details for d2bx7a_

PDB Entry: 2bx7 (more details), 2.04 Å

PDB Description: crystal structure of l. lactis dihydroorotate dehydrogense a in complex with 3,5-dihydroxybenzoate
PDB Compounds: (A:) dihydroorotate dehydrogenase

SCOPe Domain Sequences for d2bx7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bx7a_ c.1.4.1 (A:) automated matches {Lactococcus lactis [TaxId: 1358]}
mlnttfanakfanpfmnasgvhcmtiedleelkasqagayitksstlekregnplpryvd
lelgsinsmglpnlgfdyyldyvlknqkenaqegpiffsiagmsaaeniamlkkiqesdf
sgitelnlscpnvpgkpqlaydfeatekllkevftfftkplgvklppyfdlvhfdimaei
lnqfpltyvnsvnsignglfidpeaesvvikpkdgfggiggayikptalanvrafytrlk
peiqiigtggietgqdafehllcgatmlqigtalhkegpaifdriikeleeimnqkgyqs
iadfhgklksl

SCOPe Domain Coordinates for d2bx7a_:

Click to download the PDB-style file with coordinates for d2bx7a_.
(The format of our PDB-style files is described here.)

Timeline for d2bx7a_: