![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) ![]() |
![]() | Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) |
![]() | Protein automated matches [190228] (20 species) not a true protein |
![]() | Species Lactococcus lactis [TaxId:1358] [186992] (3 PDB entries) |
![]() | Domain d2bx7a_: 2bx7 A: [129395] automated match to d1dora_ complexed with 34d, act, fmn, gol, mg |
PDB Entry: 2bx7 (more details), 2.04 Å
SCOPe Domain Sequences for d2bx7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bx7a_ c.1.4.1 (A:) automated matches {Lactococcus lactis [TaxId: 1358]} mlnttfanakfanpfmnasgvhcmtiedleelkasqagayitksstlekregnplpryvd lelgsinsmglpnlgfdyyldyvlknqkenaqegpiffsiagmsaaeniamlkkiqesdf sgitelnlscpnvpgkpqlaydfeatekllkevftfftkplgvklppyfdlvhfdimaei lnqfpltyvnsvnsignglfidpeaesvvikpkdgfggiggayikptalanvrafytrlk peiqiigtggietgqdafehllcgatmlqigtalhkegpaifdriikeleeimnqkgyqs iadfhgklksl
Timeline for d2bx7a_: