Lineage for d2bx7a_ (2bx7 A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) 
Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) 
Protein automated matches [190228] (20 species)
not a true protein
Species Lactococcus lactis [TaxId:1358] [186992] (3 PDB entries) 
Domain d2bx7a_: 2bx7 A: [129395]
automated match to d1dora_
complexed with 34d, act, fmn, gol, mg
Details for d2bx7a_
PDB Entry: 2bx7 (more details), 2.04 Å
PDB Description: crystal structure of l. lactis dihydroorotate dehydrogense a in complex with 3,5-dihydroxybenzoate
PDB Compounds: (A:) dihydroorotate dehydrogenaseSCOPe Domain Sequences for d2bx7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bx7a_ c.1.4.1 (A:) automated matches {Lactococcus lactis [TaxId: 1358]}
mlnttfanakfanpfmnasgvhcmtiedleelkasqagayitksstlekregnplpryvd
lelgsinsmglpnlgfdyyldyvlknqkenaqegpiffsiagmsaaeniamlkkiqesdf
sgitelnlscpnvpgkpqlaydfeatekllkevftfftkplgvklppyfdlvhfdimaei
lnqfpltyvnsvnsignglfidpeaesvvikpkdgfggiggayikptalanvrafytrlk
peiqiigtggietgqdafehllcgatmlqigtalhkegpaifdriikeleeimnqkgyqs
iadfhgklksl
SCOPe Domain Coordinates for d2bx7a_:
Click to download the PDB-style file with coordinates for d2bx7a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bx7a_:
- d2bx7a_ first appeared in SCOP 1.73, called d2bx7a1
- d2bx7a_ appears in SCOPe 2.07
View in 3D
