Lineage for d2bszb_ (2bsz B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155423Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2155424Protein automated matches [190230] (20 species)
    not a true protein
  7. 2155529Species Rhizobium loti [TaxId:381] [186994] (1 PDB entry)
  8. 2155530Domain d2bszb_: 2bsz B: [129132]
    Other proteins in same PDB: d2bsza1
    automated match to d1gx3a_

Details for d2bszb_

PDB Entry: 2bsz (more details), 2 Å

PDB Description: Structure of Mesorhizobium loti arylamine N-acetyltransferase 1
PDB Compounds: (B:) arylamine n-acetyltransferase 1

SCOPe Domain Sequences for d2bszb_:

Sequence, based on SEQRES records: (download)

>d2bszb_ d.3.1.0 (B:) automated matches {Rhizobium loti [TaxId: 381]}
fdldaylarigytgprnasldtlkalhfahpqaipfenidpflgrpvrldlaalqdkivl
ggrggycfehnllfmhalkalgfevgglaarvlwgqsedaitarshmllrveldgrtyia
dvgfggltltaplllepgreqktphepfriveaddhfrlqaaiggdwrslyrfdlqpqye
vdysvtnyflstsptshflssviaaraapdrryalrgnrlsihhlggrteqteiataadl
adtlqgllgiiipdrtafeakvretkiv

Sequence, based on observed residues (ATOM records): (download)

>d2bszb_ d.3.1.0 (B:) automated matches {Rhizobium loti [TaxId: 381]}
fdldaylarigytgprnasldtlkalhfahpqaipfenidpflgrpvrldlaalqdkivl
ggrggycfehnllfmhalkalgfevgglaarvlwgqsedaitarshmllrveldgrtyia
dvgfggltltaplllepgreqktphepfriveaddhfrlqaaiggdwrslyrfdlqpqye
vdysvtnyflstsptshflssviaaraapdrryalrgnrlsihhteqteiataadladtl
qgllgiiipdrtafeakvretkiv

SCOPe Domain Coordinates for d2bszb_:

Click to download the PDB-style file with coordinates for d2bszb_.
(The format of our PDB-style files is described here.)

Timeline for d2bszb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bsza1