![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.0: automated matches [191342] (1 protein) not a true family |
![]() | Protein automated matches [190230] (23 species) not a true protein |
![]() | Species Rhizobium loti [TaxId:381] [186994] (1 PDB entry) |
![]() | Domain d2bszb_: 2bsz B: [129132] Other proteins in same PDB: d2bsza1 automated match to d1gx3a_ |
PDB Entry: 2bsz (more details), 2 Å
SCOPe Domain Sequences for d2bszb_:
Sequence, based on SEQRES records: (download)
>d2bszb_ d.3.1.0 (B:) automated matches {Rhizobium loti [TaxId: 381]} fdldaylarigytgprnasldtlkalhfahpqaipfenidpflgrpvrldlaalqdkivl ggrggycfehnllfmhalkalgfevgglaarvlwgqsedaitarshmllrveldgrtyia dvgfggltltaplllepgreqktphepfriveaddhfrlqaaiggdwrslyrfdlqpqye vdysvtnyflstsptshflssviaaraapdrryalrgnrlsihhlggrteqteiataadl adtlqgllgiiipdrtafeakvretkiv
>d2bszb_ d.3.1.0 (B:) automated matches {Rhizobium loti [TaxId: 381]} fdldaylarigytgprnasldtlkalhfahpqaipfenidpflgrpvrldlaalqdkivl ggrggycfehnllfmhalkalgfevgglaarvlwgqsedaitarshmllrveldgrtyia dvgfggltltaplllepgreqktphepfriveaddhfrlqaaiggdwrslyrfdlqpqye vdysvtnyflstsptshflssviaaraapdrryalrgnrlsihhteqteiataadladtl qgllgiiipdrtafeakvretkiv
Timeline for d2bszb_: