![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.5: Arylamine N-acetyltransferase [54047] (2 proteins) fold similar to that of the factor XIII catalytic domain automatically mapped to Pfam PF00797 |
![]() | Protein Arylamine N-acetyltransferase [54048] (4 species) |
![]() | Species Rhizobium loti [TaxId:381] [142854] (1 PDB entry) Uniprot Q98D42 6-275 |
![]() | Domain d2bsza1: 2bsz A:6-275 [129131] Other proteins in same PDB: d2bszb_ |
PDB Entry: 2bsz (more details), 2 Å
SCOPe Domain Sequences for d2bsza1:
Sequence, based on SEQRES records: (download)
>d2bsza1 d.3.1.5 (A:6-275) Arylamine N-acetyltransferase {Rhizobium loti [TaxId: 381]} pfdldaylarigytgprnasldtlkalhfahpqaipfenidpflgrpvrldlaalqdkiv lggrggycfehnllfmhalkalgfevgglaarvlwgqsedaitarshmllrveldgrtyi advgfggltltaplllepgreqktphepfriveaddhfrlqaaiggdwrslyrfdlqpqy evdysvtnyflstsptshflssviaaraapdrryalrgnrlsihhlggrteqteiataad ladtlqgllgiiipdrtafeakvretkive
>d2bsza1 d.3.1.5 (A:6-275) Arylamine N-acetyltransferase {Rhizobium loti [TaxId: 381]} pfdldaylarigytgprnasldtlkalhfahpqaipfenidpflgrpvrldlaalqdkiv lggrggycfehnllfmhalkalgfevgglaarvlwgqsedaitarshmllrveldgrtyi advgfggltltaplllepgreqktphepfriveaddhfrlqaaiggdwrslyrfdlqpqy evdysvtnyflstsptshflssviaaraapdrryalrgnrlsihhlteqteiataadlad tlqgllgiiipdrtafeakvretkive
Timeline for d2bsza1: