Lineage for d2bsza1 (2bsz A:6-275)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155126Family d.3.1.5: Arylamine N-acetyltransferase [54047] (2 protein domains)
    fold similar to that of the factor XIII catalytic domain
    automatically mapped to Pfam PF00797
  6. 2155127Protein Arylamine N-acetyltransferase [54048] (4 species)
  7. 2155140Species Rhizobium loti [TaxId:381] [142854] (1 PDB entry)
    Uniprot Q98D42 6-275
  8. 2155141Domain d2bsza1: 2bsz A:6-275 [129131]
    Other proteins in same PDB: d2bszb_

Details for d2bsza1

PDB Entry: 2bsz (more details), 2 Å

PDB Description: Structure of Mesorhizobium loti arylamine N-acetyltransferase 1
PDB Compounds: (A:) arylamine n-acetyltransferase 1

SCOPe Domain Sequences for d2bsza1:

Sequence, based on SEQRES records: (download)

>d2bsza1 d.3.1.5 (A:6-275) Arylamine N-acetyltransferase {Rhizobium loti [TaxId: 381]}
pfdldaylarigytgprnasldtlkalhfahpqaipfenidpflgrpvrldlaalqdkiv
lggrggycfehnllfmhalkalgfevgglaarvlwgqsedaitarshmllrveldgrtyi
advgfggltltaplllepgreqktphepfriveaddhfrlqaaiggdwrslyrfdlqpqy
evdysvtnyflstsptshflssviaaraapdrryalrgnrlsihhlggrteqteiataad
ladtlqgllgiiipdrtafeakvretkive

Sequence, based on observed residues (ATOM records): (download)

>d2bsza1 d.3.1.5 (A:6-275) Arylamine N-acetyltransferase {Rhizobium loti [TaxId: 381]}
pfdldaylarigytgprnasldtlkalhfahpqaipfenidpflgrpvrldlaalqdkiv
lggrggycfehnllfmhalkalgfevgglaarvlwgqsedaitarshmllrveldgrtyi
advgfggltltaplllepgreqktphepfriveaddhfrlqaaiggdwrslyrfdlqpqy
evdysvtnyflstsptshflssviaaraapdrryalrgnrlsihhlteqteiataadlad
tlqgllgiiipdrtafeakvretkive

SCOPe Domain Coordinates for d2bsza1:

Click to download the PDB-style file with coordinates for d2bsza1.
(The format of our PDB-style files is described here.)

Timeline for d2bsza1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bszb_