Lineage for d2bszb1 (2bsz B:7-274)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 715176Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 715177Superfamily d.3.1: Cysteine proteinases [54001] (16 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 715528Family d.3.1.5: Arylamine N-acetyltransferase [54047] (1 protein)
    fold similar to that of the factor XIII catalytic domain
  6. 715529Protein Arylamine N-acetyltransferase [54048] (4 species)
  7. 715543Species Rhizobium loti [TaxId:381] [142854] (1 PDB entry)
  8. 715545Domain d2bszb1: 2bsz B:7-274 [129132]
    automatically matched to 2BSZ A:6-275

Details for d2bszb1

PDB Entry: 2bsz (more details), 2 Å

PDB Description: Structure of Mesorhizobium loti arylamine N-acetyltransferase 1
PDB Compounds: (B:) arylamine n-acetyltransferase 1

SCOP Domain Sequences for d2bszb1:

Sequence, based on SEQRES records: (download)

>d2bszb1 d.3.1.5 (B:7-274) Arylamine N-acetyltransferase {Rhizobium loti [TaxId: 381]}
fdldaylarigytgprnasldtlkalhfahpqaipfenidpflgrpvrldlaalqdkivl
ggrggycfehnllfmhalkalgfevgglaarvlwgqsedaitarshmllrveldgrtyia
dvgfggltltaplllepgreqktphepfriveaddhfrlqaaiggdwrslyrfdlqpqye
vdysvtnyflstsptshflssviaaraapdrryalrgnrlsihhlggrteqteiataadl
adtlqgllgiiipdrtafeakvretkiv

Sequence, based on observed residues (ATOM records): (download)

>d2bszb1 d.3.1.5 (B:7-274) Arylamine N-acetyltransferase {Rhizobium loti [TaxId: 381]}
fdldaylarigytgprnasldtlkalhfahpqaipfenidpflgrpvrldlaalqdkivl
ggrggycfehnllfmhalkalgfevgglaarvlwgqsedaitarshmllrveldgrtyia
dvgfggltltaplllepgreqktphepfriveaddhfrlqaaiggdwrslyrfdlqpqye
vdysvtnyflstsptshflssviaaraapdrryalrgnrlsihhteqteiataadladtl
qgllgiiipdrtafeakvretkiv

SCOP Domain Coordinates for d2bszb1:

Click to download the PDB-style file with coordinates for d2bszb1.
(The format of our PDB-style files is described here.)

Timeline for d2bszb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bsza1