SCOPe 2.08: Domain d2bskd1: 2bsk D:13-77

Lineage for d2bskd1 (2bsk D:13-77)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.83: Tim10-like [144121] (1 superfamily)
   alpha-hairpin crosslinked by two disulfides; assembles into a heterohexameric ring-like structure

4. Superfamily g.83.1: Tim10-like [144122] (2 families)

5. Family g.83.1.1: Tim10/DDP [144123] (2 proteins)
   Pfam PF02953; note: not a zinc finger

6. Protein Mitochondrial import inner membrane translocase subunit Tim10 [144126] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [144127] (1 PDB entry)
   Uniprot P62072 13-77

8. Domain d2bskd1: 2bsk D:13-77 [129093]
   Other proteins in same PDB: d2bska1, d2bskc1
   automatically matched to 2BSK B:13-77

Details for d2bskd1

PDB Entry: 2bsk, 3.3 Å

PDB Description: crystal structure of the tim9 tim10 hexameric complex

PDB Compounds: (D:) mitochondrial import inner membrane translocase subunit tim10

SCOPe Domain Sequences for d2bskd1:

Sequence; same for both SEQRES and ATOM records:

>d2bskd1 g.83.1.1 (D:13-77) Mitochondrial import inner membrane translocase subunit Tim10 {Human (Homo sapiens) [TaxId: 9606]}
levemmadmynrmtsachrkcvpphykeaelskgesvcldrcvskyldihermgkkltel
smqde

Timeline for d2bskd1:

• d2bskd1 first appeared in SCOP 1.73
  
• d2bskd1 appears in SCOPe 2.07