Class g: Small proteins [56992] (85 folds) |
Fold g.83: Tim10-like [144121] (1 superfamily) alpha-hairpin crosslinked by two disulfides; assembles into a heterohexameric ring-like structure |
Superfamily g.83.1: Tim10-like [144122] (1 family) |
Family g.83.1.1: Tim10/DDP [144123] (2 proteins) Pfam PF02953; note: not a zinc finger |
Protein Mitochondrial import inner membrane translocase subunit Tim10 [144126] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [144127] (1 PDB entry) |
Domain d2bskd1: 2bsk D:13-77 [129093] Other proteins in same PDB: d2bska1, d2bskc1 automatically matched to 2BSK B:13-77 |
PDB Entry: 2bsk (more details), 3.3 Å
SCOP Domain Sequences for d2bskd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bskd1 g.83.1.1 (D:13-77) Mitochondrial import inner membrane translocase subunit Tim10 {Human (Homo sapiens) [TaxId: 9606]} levemmadmynrmtsachrkcvpphykeaelskgesvcldrcvskyldihermgkkltel smqde
Timeline for d2bskd1:
View in 3D Domains from other chains: (mouse over for more information) d2bska1, d2bskb1, d2bskc1, d2bskf1 |