| Class g: Small proteins [56992] (100 folds) |
| Fold g.83: Tim10-like [144121] (1 superfamily) alpha-hairpin crosslinked by two disulfides; assembles into a heterohexameric ring-like structure |
Superfamily g.83.1: Tim10-like [144122] (2 families) ![]() |
| Family g.83.1.1: Tim10/DDP [144123] (2 proteins) Pfam PF02953; note: not a zinc finger |
| Protein Mitochondrial import inner membrane translocase subunit Tim9 [144124] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [144125] (1 PDB entry) Uniprot Q9Y5J7 13-85 |
| Domain d2bskc1: 2bsk C:13-85 [129092] Other proteins in same PDB: d2bskb1, d2bskd1, d2bskf1 automatically matched to 2BSK A:13-85 |
PDB Entry: 2bsk (more details), 3.3 Å
SCOPe Domain Sequences for d2bskc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bskc1 g.83.1.1 (C:13-85) Mitochondrial import inner membrane translocase subunit Tim9 {Human (Homo sapiens) [TaxId: 9606]}
qfkeflgtynkltetcfldcvkdfttrevkpeettcsehclqkylkmtqrismrfqeyhi
qqnealaakagll
Timeline for d2bskc1:
View in 3DDomains from other chains: (mouse over for more information) d2bska1, d2bskb1, d2bskd1, d2bskf1 |