![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.83: Tim10-like [144121] (1 superfamily) alpha-hairpin crosslinked by two disulfides; assembles into a heterohexameric ring-like structure |
![]() | Superfamily g.83.1: Tim10-like [144122] (2 families) ![]() |
![]() | Family g.83.1.1: Tim10/DDP [144123] (2 proteins) Pfam PF02953; note: not a zinc finger |
![]() | Protein Mitochondrial import inner membrane translocase subunit Tim10 [144126] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [144127] (1 PDB entry) Uniprot P62072 13-77 |
![]() | Domain d2bskf1: 2bsk F:13-73 [129094] Other proteins in same PDB: d2bska1, d2bskc1 automatically matched to 2BSK B:13-77 |
PDB Entry: 2bsk (more details), 3.3 Å
SCOPe Domain Sequences for d2bskf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bskf1 g.83.1.1 (F:13-73) Mitochondrial import inner membrane translocase subunit Tim10 {Human (Homo sapiens) [TaxId: 9606]} levemmadmynrmtsachrkcvpphykeaelskgesvcldrcvskyldihermgkkltel s
Timeline for d2bskf1:
![]() Domains from other chains: (mouse over for more information) d2bska1, d2bskb1, d2bskc1, d2bskd1 |