Lineage for d2bnxb_ (2bnx B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006858Family a.118.1.23: Diap1 N-terninal region-like [140830] (2 protein domains)
    contains two consequitive Pfam domains in one superhelical segment: Pfam PF06371 and Pfam PF06367
  6. 2006859Protein Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) [140831] (1 species)
  7. 2006860Species Mouse (Mus musculus) [TaxId:10090] [140832] (4 PDB entries)
    Uniprot O08808 133-475! Uniprot O08808 135-435! Uniprot O08808 83-443
  8. 2006862Domain d2bnxb_: 2bnx B: [128862]
    automated match to d2bnxa1
    complexed with cl

Details for d2bnxb_

PDB Entry: 2bnx (more details), 2.4 Å

PDB Description: crystal structure of the dimeric regulatory domain of mouse diaphaneous-related formin (drf), mdia1
PDB Compounds: (B:) Diaphanous protein homolog 1

SCOPe Domain Sequences for d2bnxb_:

Sequence, based on SEQRES records: (download)

>d2bnxb_ a.118.1.23 (B:) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]}
srsammyiqelrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkrlhde
keetsgnydsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmidaak
llsalcilpqpedmnervleamteraemdeverfqplldglksgtsialkvgclqlinal
itpaeeldfrvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgrld
dirmemddfgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvsqi
vlhkngtdpdfkcrhlqidierlvdqmidktkvekseakate

Sequence, based on observed residues (ATOM records): (download)

>d2bnxb_ a.118.1.23 (B:) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]}
srsammyiqelrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkrlhde
keetsgnydsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmidaak
llsalcilpqpedmnervleamteraemdeverfqplldglksgtsialkvgclqlinal
itpaeeldfrvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgrld
memddfgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvsqivlh
kngtdpdfkcrhlqidierlvdqmidktkvekseakate

SCOPe Domain Coordinates for d2bnxb_:

Click to download the PDB-style file with coordinates for d2bnxb_.
(The format of our PDB-style files is described here.)

Timeline for d2bnxb_: