![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
![]() | Family a.118.1.23: Diap1 N-terninal region-like [140830] (2 proteins) contains two consequitive Pfam domains in one superhelical segment: Pfam PF06371 and Pfam PF06367 this is a repeat family; one repeat unit is 2bap A:217-262 found in domain |
![]() | Protein Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) [140831] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [140832] (4 PDB entries) Uniprot O08808 133-475! Uniprot O08808 135-435! Uniprot O08808 83-443 |
![]() | Domain d2bnxa1: 2bnx A:133-475 [128861] complexed with cl |
PDB Entry: 2bnx (more details), 2.4 Å
SCOPe Domain Sequences for d2bnxa1:
Sequence, based on SEQRES records: (download)
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} srsammyiqelrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkrlhde keetsgnydsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmidaak llsalcilpqpedmnervleamteraemdeverfqplldglksgtsialkvgclqlinal itpaeeldfrvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgrld dirmemddfgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvsqi vlhkngtdpdfkcrhlqidierlvdqmidktkvekseakatel
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} srsammyiqelrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkrlhde keetsgnydsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmidaak llsalcilpqpedmnervleamteraemdeverfqplldglksgtsialkvgclqlinal itpaeeldfrvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgrld dirmemddfgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvsqi vlhkngtdpdfkcrhlqidierlvktkvekseakatel
Timeline for d2bnxa1: