Lineage for d2bnxb1 (2bnx B:133-474)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646820Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 646821Superfamily a.118.1: ARM repeat [48371] (22 families) (S)
  5. 647094Family a.118.1.23: Diap1 N-terninal region-like [140830] (1 protein)
    contains two consequitive Pfam domains in one superhelical segment: Pfam PF06371 and Pfam 06367
    this is a repeat family; one repeat unit is 2bap A:217-262 found in domain
  6. 647095Protein Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) [140831] (1 species)
  7. 647096Species Mouse (Mus musculus) [TaxId:10090] [140832] (3 PDB entries)
  8. 647098Domain d2bnxb1: 2bnx B:133-474 [128862]
    automatically matched to 2BNX A:133-475
    complexed with cl

Details for d2bnxb1

PDB Entry: 2bnx (more details), 2.4 Å

PDB Description: crystal structure of the dimeric regulatory domain of mouse diaphaneous-related formin (drf), mdia1
PDB Compounds: (B:) Diaphanous protein homolog 1

SCOP Domain Sequences for d2bnxb1:

Sequence, based on SEQRES records: (download)

>d2bnxb1 a.118.1.23 (B:133-474) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]}
srsammyiqelrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkrlhde
keetsgnydsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmidaak
llsalcilpqpedmnervleamteraemdeverfqplldglksgtsialkvgclqlinal
itpaeeldfrvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgrld
dirmemddfgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvsqi
vlhkngtdpdfkcrhlqidierlvdqmidktkvekseakate

Sequence, based on observed residues (ATOM records): (download)

>d2bnxb1 a.118.1.23 (B:133-474) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]}
srsammyiqelrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkrlhde
keetsgnydsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmidaak
llsalcilpqpedmnervleamteraemdeverfqplldglksgtsialkvgclqlinal
itpaeeldfrvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgrld
memddfgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvsqivlh
kngtdpdfkcrhlqidierlvdqmidktkvekseakate

SCOP Domain Coordinates for d2bnxb1:

Click to download the PDB-style file with coordinates for d2bnxb1.
(The format of our PDB-style files is described here.)

Timeline for d2bnxb1: