SCOP 1.73: Domain d2bgci2: 2bgc I:7-137

Lineage for d2bgci2 (2bgc I:7-137)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families)

5. Family b.82.3.3: Listeriolysin regulatory protein PrfA, N-terminal domain [89419] (1 protein)

6. Protein Listeriolysin regulatory protein PrfA, N-terminal domain [89420] (1 species)

7. Species Bacteria (Listeria monocytogenes) [TaxId:1639] [89421] (3 PDB entries)

8. Domain d2bgci2: 2bgc I:7-137 [128473]
   Other proteins in same PDB: d2bgca1, d2bgcb1, d2bgcd1, d2bgce1, d2bgcf1, d2bgcg1, d2bgch1, d2bgci1
   automatically matched to d1omia1
   complexed with dtt, dtu; mutant

Details for d2bgci2

PDB Entry: 2bgc, 2.3 Å

PDB Description: prfa-g145s, a constitutive active mutant of the transcriptional regulator in l.monocytogenes

PDB Compounds: (I:) prfa

SCOP Domain Sequences for d2bgci2:

Sequence; same for both SEQRES and ATOM records:

>d2bgci2 b.82.3.3 (I:7-137) Listeriolysin regulatory protein PrfA, N-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]}
efkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlqyykga
fvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlqkqvsy
slakfndfsin

Timeline for d2bgci2:

• d2bgci2 is new in SCOP 1.73
  
• d2bgci2 appears in SCOP 1.75
  
• d2bgci2 appears in the current release, SCOPe 2.08