Class a: All alpha proteins [46456] (258 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) contains a small beta-sheet (wing) |
Family a.4.5.4: CAP C-terminal domain-like [46796] (6 proteins) |
Protein Listeriolysin regulatory protein PrfA, C-terminal domain [88975] (1 species) |
Species Bacteria (Listeria monocytogenes) [TaxId:1639] [88976] (3 PDB entries) |
Domain d2bgca1: 2bgc A:138-237 [128458] Other proteins in same PDB: d2bgca2, d2bgcb2, d2bgcd2, d2bgce2, d2bgcf2, d2bgcg2, d2bgch2, d2bgci2 automatically matched to d1omia2 complexed with dtt, dtu; mutant |
PDB Entry: 2bgc (more details), 2.3 Å
SCOP Domain Sequences for d2bgca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bgca1 a.4.5.4 (A:138-237) Listeriolysin regulatory protein PrfA, C-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]} gklgsicsqlliltyvygketpdgikitldnltmqelgyssgiahssavsriisklkqek vivyknscfyvqnldylkryapkldewfylacpatwgkln
Timeline for d2bgca1: