SCOP 1.73: Domain d2bgca1: 2bgc A:138-237

Lineage for d2bgca1 (2bgc A:138-237)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.4: CAP C-terminal domain-like [46796] (6 proteins)

6. Protein Listeriolysin regulatory protein PrfA, C-terminal domain [88975] (1 species)

7. Species Bacteria (Listeria monocytogenes) [TaxId:1639] [88976] (3 PDB entries)

8. Domain d2bgca1: 2bgc A:138-237 [128458]
   Other proteins in same PDB: d2bgca2, d2bgcb2, d2bgcd2, d2bgce2, d2bgcf2, d2bgcg2, d2bgch2, d2bgci2
   automatically matched to d1omia2
   complexed with dtt, dtu; mutant

Details for d2bgca1

PDB Entry: 2bgc, 2.3 Å

PDB Description: prfa-g145s, a constitutive active mutant of the transcriptional regulator in l.monocytogenes

PDB Compounds: (A:) prfa

SCOP Domain Sequences for d2bgca1:

Sequence; same for both SEQRES and ATOM records:

>d2bgca1 a.4.5.4 (A:138-237) Listeriolysin regulatory protein PrfA, C-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]}
gklgsicsqlliltyvygketpdgikitldnltmqelgyssgiahssavsriisklkqek
vivyknscfyvqnldylkryapkldewfylacpatwgkln

Timeline for d2bgca1:

• d2bgca1 is new in SCOP 1.73
  
• d2bgca1 appears in SCOP 1.75
  
• d2bgca1 appears in the current release, SCOPe 2.08