Lineage for d2bgce2 (2bgc E:7-137)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 677266Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 677861Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families) (S)
  5. 677954Family b.82.3.3: Listeriolysin regulatory protein PrfA, N-terminal domain [89419] (1 protein)
  6. 677955Protein Listeriolysin regulatory protein PrfA, N-terminal domain [89420] (1 species)
  7. 677956Species Bacteria (Listeria monocytogenes) [TaxId:1639] [89421] (3 PDB entries)
  8. 677960Domain d2bgce2: 2bgc E:7-137 [128465]
    Other proteins in same PDB: d2bgca1, d2bgcb1, d2bgcd1, d2bgce1, d2bgcf1, d2bgcg1, d2bgch1, d2bgci1
    automatically matched to d1omia1
    complexed with dtt, dtu; mutant

Details for d2bgce2

PDB Entry: 2bgc (more details), 2.3 Å

PDB Description: prfa-g145s, a constitutive active mutant of the transcriptional regulator in l.monocytogenes
PDB Compounds: (E:) prfa

SCOP Domain Sequences for d2bgce2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bgce2 b.82.3.3 (E:7-137) Listeriolysin regulatory protein PrfA, N-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]}
efkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlqyykga
fvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlqkqvsy
slakfndfsin

SCOP Domain Coordinates for d2bgce2:

Click to download the PDB-style file with coordinates for d2bgce2.
(The format of our PDB-style files is described here.)

Timeline for d2bgce2: