Lineage for d2bgcg1 (2bgc G:138-237)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634918Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) (S)
    contains a small beta-sheet (wing)
  5. 634956Family a.4.5.4: CAP C-terminal domain-like [46796] (6 proteins)
  6. 634998Protein Listeriolysin regulatory protein PrfA, C-terminal domain [88975] (1 species)
  7. 634999Species Bacteria (Listeria monocytogenes) [TaxId:1639] [88976] (3 PDB entries)
  8. 635005Domain d2bgcg1: 2bgc G:138-237 [128468]
    Other proteins in same PDB: d2bgca2, d2bgcb2, d2bgcd2, d2bgce2, d2bgcf2, d2bgcg2, d2bgch2, d2bgci2
    automatically matched to d1omia2
    complexed with dtt, dtu; mutant

Details for d2bgcg1

PDB Entry: 2bgc (more details), 2.3 Å

PDB Description: prfa-g145s, a constitutive active mutant of the transcriptional regulator in l.monocytogenes
PDB Compounds: (G:) prfa

SCOP Domain Sequences for d2bgcg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bgcg1 a.4.5.4 (G:138-237) Listeriolysin regulatory protein PrfA, C-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]}
gklgsicsqlliltyvygketpdgikitldnltmqelgyssgiahssavsriisklkqek
vivyknscfyvqnldylkryapkldewfylacpatwgkln

SCOP Domain Coordinates for d2bgcg1:

Click to download the PDB-style file with coordinates for d2bgcg1.
(The format of our PDB-style files is described here.)

Timeline for d2bgcg1: