![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families) ![]() |
![]() | Family b.82.3.3: Listeriolysin regulatory protein PrfA, N-terminal domain [89419] (1 protein) |
![]() | Protein Listeriolysin regulatory protein PrfA, N-terminal domain [89420] (1 species) |
![]() | Species Bacteria (Listeria monocytogenes) [TaxId:1639] [89421] (3 PDB entries) |
![]() | Domain d2bgch2: 2bgc H:7-137 [128471] Other proteins in same PDB: d2bgca1, d2bgcb1, d2bgcd1, d2bgce1, d2bgcf1, d2bgcg1, d2bgch1, d2bgci1 automatically matched to d1omia1 complexed with dtt, dtu; mutant |
PDB Entry: 2bgc (more details), 2.3 Å
SCOP Domain Sequences for d2bgch2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bgch2 b.82.3.3 (H:7-137) Listeriolysin regulatory protein PrfA, N-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]} efkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlqyykga fvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlqkqvsy slakfndfsin
Timeline for d2bgch2: