![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
![]() | Superfamily g.44.1: RING/U-box [57850] (7 families) ![]() |
![]() | Family g.44.1.2: U-box [90222] (5 proteins) Associated with multi-ubiquitination; lacks the RING-domain metal ion-binding residues |
![]() | Protein automated matches [190212] (2 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186968] (1 PDB entry) |
![]() | Domain d2bayd2: 2bay D:1-55 [128254] Other proteins in same PDB: d2bayd3, d2baye3, d2bayf3 automated match to d1n87a_ |
PDB Entry: 2bay (more details), 1.5 Å
SCOPe Domain Sequences for d2bayd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bayd2 g.44.1.2 (D:1-55) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mlcaisgkvprrpvlspksrtifekslleqyvkdtgndpitneplsieeiveivp
Timeline for d2bayd2: