Lineage for d2bayd1 (2bay D:1-55)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 751391Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 751392Superfamily g.44.1: RING/U-box [57850] (4 families) (S)
  5. 751440Family g.44.1.2: U-box [90222] (4 proteins)
    Associated with multi-ubiquitination; lacks the RING-domain metal ion-binding residues
  6. 751444Protein Pre-mRNA splicing factor Prp19 [90223] (1 species)
  7. 751445Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90224] (2 PDB entries)
  8. 751449Domain d2bayd1: 2bay D:1-55 [128254]
    automatically matched to d1n87a_

Details for d2bayd1

PDB Entry: 2bay (more details), 1.5 Å

PDB Description: Crystal structure of the Prp19 U-box dimer
PDB Compounds: (D:) Pre-mRNA splicing factor PRP19

SCOP Domain Sequences for d2bayd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bayd1 g.44.1.2 (D:1-55) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mlcaisgkvprrpvlspksrtifekslleqyvkdtgndpitneplsieeiveivp

SCOP Domain Coordinates for d2bayd1:

Click to download the PDB-style file with coordinates for d2bayd1.
(The format of our PDB-style files is described here.)

Timeline for d2bayd1: