Class g: Small proteins [56992] (98 folds) |
Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
Superfamily g.44.1: RING/U-box [57850] (7 families) |
Family g.44.1.2: U-box [90222] (5 proteins) Associated with multi-ubiquitination; lacks the RING-domain metal ion-binding residues |
Protein automated matches [190212] (2 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186968] (1 PDB entry) |
Domain d2bayf2: 2bay F:1-57 [128256] Other proteins in same PDB: d2bayd3, d2baye3, d2bayf3 automated match to d1n87a_ |
PDB Entry: 2bay (more details), 1.5 Å
SCOPe Domain Sequences for d2bayf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bayf2 g.44.1.2 (F:1-57) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mlcaisgkvprrpvlspksrtifekslleqyvkdtgndpitneplsieeiveivpsa
Timeline for d2bayf2: