SCOPe 2.08: Domain d2bayd2: 2bay D:1-55

Lineage for d2bayd2 (2bay D:1-55)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.2: U-box [90222] (5 proteins)
   Associated with multi-ubiquitination; lacks the RING-domain metal ion-binding residues

6. Protein automated matches [190212] (2 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186968] (1 PDB entry)

8. Domain d2bayd2: 2bay D:1-55 [128254]
   Other proteins in same PDB: d2bayd3, d2baye3, d2bayf3
   automated match to d1n87a_

Details for d2bayd2

PDB Entry: 2bay, 1.5 Å

PDB Description: Crystal structure of the Prp19 U-box dimer

PDB Compounds: (D:) Pre-mRNA splicing factor PRP19

SCOPe Domain Sequences for d2bayd2:

Sequence; same for both SEQRES and ATOM records:

>d2bayd2 g.44.1.2 (D:1-55) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mlcaisgkvprrpvlspksrtifekslleqyvkdtgndpitneplsieeiveivp

Timeline for d2bayd2:

• d2bayd2 first appeared in SCOP 1.73, called d2bayd1
  
• d2bayd2 appears in SCOPe 2.07