![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
![]() | Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins) |
![]() | Protein automated matches [190102] (7 species) not a true protein |
![]() | Species Haemophilus influenzae [TaxId:727] [186964] (1 PDB entry) |
![]() | Domain d2b6eb2: 2b6e B:1-138 [127987] Other proteins in same PDB: d2b6eb3, d2b6ec3, d2b6ed3 automated match to d1o0ia_ complexed with acy |
PDB Entry: 2b6e (more details), 1.9 Å
SCOPe Domain Sequences for d2b6eb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b6eb2 d.38.1.5 (B:1-138) automated matches {Haemophilus influenzae [TaxId: 727]} mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsva laetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirt eenklccvsrltlsvinl
Timeline for d2b6eb2: