PDB entry 2b6e

View 2b6e on RCSB PDB site
Description: X-Ray Crystal Structure of Protein HI1161 from Haemophilus influenzae. Northeast Structural Genomics Consortium Target IR63.
Class: structural genomics, unknown function
Keywords: X-Ray,ir63, NESG, P45083, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2005-10-01, released 2005-10-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.191
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical UPF0152 protein HI1161
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45083 (0-End)
      • modified residue (0)
      • modified residue (39)
      • modified residue (46)
    Domains in SCOPe 2.07: d2b6ea_
  • Chain 'B':
    Compound: Hypothetical UPF0152 protein HI1161
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45083 (0-137)
      • modified residue (0)
      • modified residue (39)
      • modified residue (46)
      • cloning artifact (138)
    Domains in SCOPe 2.07: d2b6eb2, d2b6eb3
  • Chain 'C':
    Compound: Hypothetical UPF0152 protein HI1161
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45083 (0-137)
      • modified residue (0)
      • modified residue (39)
      • modified residue (46)
      • cloning artifact (138)
    Domains in SCOPe 2.07: d2b6ec2, d2b6ec3
  • Chain 'D':
    Compound: Hypothetical UPF0152 protein HI1161
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45083 (0-137)
      • modified residue (0)
      • modified residue (39)
      • modified residue (46)
      • cloning artifact (138-139)
      • expression tag (140-145)
    Domains in SCOPe 2.07: d2b6ed2, d2b6ed3
  • Chain 'E':
    Compound: Hypothetical UPF0152 protein HI1161
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45083 (0-End)
      • modified residue (0)
      • modified residue (39)
      • modified residue (46)
    Domains in SCOPe 2.07: d2b6ee_
  • Chain 'F':
    Compound: Hypothetical UPF0152 protein HI1161
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45083 (0-137)
      • modified residue (0)
      • modified residue (39)
      • modified residue (46)
    Domains in SCOPe 2.07: d2b6ef_
  • Chain 'G':
    Compound: Hypothetical UPF0152 protein HI1161
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45083 (0-137)
      • modified residue (0)
      • modified residue (39)
      • modified residue (46)
    Domains in SCOPe 2.07: d2b6eg_
  • Chain 'H':
    Compound: Hypothetical UPF0152 protein HI1161
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45083 (0-End)
      • modified residue (0)
      • modified residue (39)
      • modified residue (46)
    Domains in SCOPe 2.07: d2b6eh_
  • Heterogens: ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b6eA (A:)
    mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsva
    laetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirt
    eenklccvsrltlsvinllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b6eA (A:)
    mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsva
    laetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirt
    eenklccvsrltlsvin
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b6eB (B:)
    mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsva
    laetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirt
    eenklccvsrltlsvinllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b6eB (B:)
    mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsva
    laetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirt
    eenklccvsrltlsvinll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2b6eC (C:)
    mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsva
    laetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirt
    eenklccvsrltlsvinllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b6eC (C:)
    mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsva
    laetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirt
    eenklccvsrltlsvinll
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b6eD (D:)
    mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsva
    laetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirt
    eenklccvsrltlsvinllehhhhhh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2b6eE (E:)
    mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsva
    laetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirt
    eenklccvsrltlsvinllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b6eE (E:)
    mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsva
    laetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirt
    eenklccvsrltlsvin
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2b6eF (F:)
    mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsva
    laetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirt
    eenklccvsrltlsvinllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b6eF (F:)
    mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsva
    laetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirt
    eenklccvsrltlsvinl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2b6eG (G:)
    mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsva
    laetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirt
    eenklccvsrltlsvinllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b6eG (G:)
    mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsva
    laetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirt
    eenklccvsrltlsvinl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2b6eH (H:)
    mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsva
    laetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirt
    eenklccvsrltlsvinllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b6eH (H:)
    mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsva
    laetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirt
    eenklccvsrltlsvin