Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) |
Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins) |
Protein automated matches [190102] (7 species) not a true protein |
Species Haemophilus influenzae [TaxId:727] [186964] (1 PDB entry) |
Domain d2b6ef_: 2b6e F: [127991] Other proteins in same PDB: d2b6eb3, d2b6ec3, d2b6ed3 automated match to d1o0ia_ complexed with acy |
PDB Entry: 2b6e (more details), 1.9 Å
SCOPe Domain Sequences for d2b6ef_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b6ef_ d.38.1.5 (F:) automated matches {Haemophilus influenzae [TaxId: 727]} mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsva laetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirt eenklccvsrltlsvinl
Timeline for d2b6ef_: