![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
![]() | Domain d2b2xm2: 2b2x M:115-215 [127753] Other proteins in same PDB: d2b2xa_, d2b2xb_, d2b2xh_, d2b2xi_, d2b2xl1, d2b2xm1 automated match to d2fbjl2 complexed with mg; mutant |
PDB Entry: 2b2x (more details), 2.2 Å
SCOPe Domain Sequences for d2b2xm2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b2xm2 b.1.1.2 (M:115-215) automated matches {Mouse (Mus musculus) [TaxId: 10090]} aaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskd stysmsstltltkdeyerhnsytceathktstspivksfnr
Timeline for d2b2xm2: