SCOPe 2.08: Domain d2b2xl1: 2b2x L:1-114

Lineage for d2b2xl1 (2b2x L:1-114)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d2b2xl1: 2b2x L:1-114 [127750]
   Other proteins in same PDB: d2b2xa_, d2b2xb_, d2b2xh_, d2b2xi_, d2b2xl2, d2b2xm2
   automated match to d2fbjl1
   complexed with mg; mutant

Details for d2b2xl1

PDB Entry: 2b2x, 2.2 Å

PDB Description: vla1 rdeltah i-domain complexed with a quadruple mutant of the aqc2 fab

PDB Compounds: (L:) Antibody AQC2 Fab

SCOPe Domain Sequences for d2b2xl1:

Sequence; same for both SEQRES and ATOM records:

>d2b2xl1 b.1.1.0 (L:1-114) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qiqltqspsslsasvgdrvtitcsassqvnhmfwyqqkpgkapkpwiyltsylasgvpsr
fsgsgsgtdytltisslqpedfatyycqqwsgnpwtfgqgtkveikrad

Timeline for d2b2xl1:

• d2b2xl1 first appeared in SCOP 1.73
  
• d2b2xl1 appears in SCOPe 2.07