Lineage for d2b2xl2 (2b2x L:115-215)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (14 species)
    not a true protein
  7. 2025381Species Mouse (Mus musculus) [TaxId:10090] [224855] (494 PDB entries)
  8. 2025620Domain d2b2xl2: 2b2x L:115-215 [127751]
    Other proteins in same PDB: d2b2xa_, d2b2xb_, d2b2xl1, d2b2xm1
    automated match to d2fbjl2
    complexed with mg; mutant

Details for d2b2xl2

PDB Entry: 2b2x (more details), 2.2 Å

PDB Description: vla1 rdeltah i-domain complexed with a quadruple mutant of the aqc2 fab
PDB Compounds: (L:) Antibody AQC2 Fab

SCOPe Domain Sequences for d2b2xl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b2xl2 b.1.1.2 (L:115-215) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskd
stysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d2b2xl2:

Click to download the PDB-style file with coordinates for d2b2xl2.
(The format of our PDB-style files is described here.)

Timeline for d2b2xl2: