Lineage for d2b2xl2 (2b2x L:115-215)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. Protein automated matches [190374] (15 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (649 PDB entries)
  8. Domain d2b2xl2: 2b2x L:115-215 [127751]
    Other proteins in same PDB: d2b2xa_, d2b2xb_, d2b2xh_, d2b2xi_, d2b2xl1, d2b2xm1
    automated match to d2fbjl2
    complexed with mg; mutant

Details for d2b2xl2

PDB Entry: 2b2x (more details), 2.2 Å

PDB Description: vla1 rdeltah i-domain complexed with a quadruple mutant of the aqc2 fab
PDB Compounds: (L:) Antibody AQC2 Fab

SCOPe Domain Sequences for d2b2xl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b2xl2 b.1.1.2 (L:115-215) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskd
stysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d2b2xl2 are not available.

Timeline for d2b2xl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2b2xl1
View in 3D
Domains from other chains:
(mouse over for more information)
d2b2xa_, d2b2xb_, d2b2xh_, d2b2xi_, d2b2xm1, d2b2xm2