Lineage for d2b2xb_ (2b2x B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892194Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2892195Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2892196Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)
  6. 2892236Protein Integrin alpha1-beta1 [53310] (2 species)
  7. 2892245Species Norway rat (Rattus norvegicus) [TaxId:10116] [53312] (3 PDB entries)
  8. 2892249Domain d2b2xb_: 2b2x B: [127749]
    Other proteins in same PDB: d2b2xh_, d2b2xi_, d2b2xl1, d2b2xl2, d2b2xm1, d2b2xm2
    automated match to d1qcya_
    complexed with mg; mutant

Details for d2b2xb_

PDB Entry: 2b2x (more details), 2.2 Å

PDB Description: vla1 rdeltah i-domain complexed with a quadruple mutant of the aqc2 fab
PDB Compounds: (B:) integrin alpha-1

SCOPe Domain Sequences for d2b2xb_:

Sequence, based on SEQRES records: (download)

>d2b2xb_ c.62.1.1 (B:) Integrin alpha1-beta1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ldivivldgsnsiypwesviaflndllkrmdigpkqtqvgivqygenvthefnlnkysst
eevlvaankivqrggrqtmtalgidtarkeafteargarrgvkkvmvivtdgeshdnyrl
kqviqdcedeniqrfsiailghynrgnlstekfveeiksiaseptekhffnvsdelalvt
ivkalgerif

Sequence, based on observed residues (ATOM records): (download)

>d2b2xb_ c.62.1.1 (B:) Integrin alpha1-beta1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ldivivldgsnsiypwesviaflndllkrgpkqtqvgivqygenvthefnlnkyseevlv
aankivqrggrqtmtalgidtarkeafteargarkvmvivtdgeshdnyrlkqviqdced
eniqrfsiailghystekfveeiksiaseptekhffnvsdelalvtivkalgerif

SCOPe Domain Coordinates for d2b2xb_:

Click to download the PDB-style file with coordinates for d2b2xb_.
(The format of our PDB-style files is described here.)

Timeline for d2b2xb_: