Lineage for d2b2cb_ (2b2c B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129722Family c.66.1.17: Spermidine synthase [69557] (3 protein domains)
    contains additional N-terminal tetramerisation all-beta domain, res. 1-71
  6. 2129767Protein automated matches [190432] (5 species)
    not a true protein
  7. 2129771Species Nematode (Caenorhabditis elegans) [TaxId:6239] [187439] (1 PDB entry)
  8. 2129772Domain d2b2cb_: 2b2c B: [127707]
    Other proteins in same PDB: d2b2ca1
    automated match to d2b2ca1

Details for d2b2cb_

PDB Entry: 2b2c (more details), 2.5 Å

PDB Description: cloning, expression, characterisation and three- dimensional structure determination of the caenorhabditis elegans spermidine synthase
PDB Compounds: (B:) spermidine synthase

SCOPe Domain Sequences for d2b2cb_:

Sequence, based on SEQRES records: (download)

>d2b2cb_ c.66.1.17 (B:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
klhkgwftefspddlekmngasdeeptkvlksdgqemggawpgqafslqvkkvlfheksk
yqdvlvfesttygnvlvldgivqaterdefsyqemlahlpmfahpdpkrvliigggdggi
lrevlkhesvekvtmceidemvidvakkflpgmscgfshpkldlfcgdgfeflknhknef
dviitdssdpvgpaeslfgqsyyellrdalkedgilssqgesvwlhlpliahlvafnrki
fpavtyaqsivstypsgsmgylicaknanrdvttpartltaeqikalnlrfynsevhkaa
fvlpqfvknale

Sequence, based on observed residues (ATOM records): (download)

>d2b2cb_ c.66.1.17 (B:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
klhkgwftefspddlgawpgqafslqvkkvlfhekskyqdvlvfesttygnvlvldgivq
aterdefsyqemlahlpmfahpdpkrvliigggdggilrevlkhesvekvtmceidemvi
dvakkflpgmscgfshpkldlfcgdgfeflknhknefdviitdssyyellrdalkedgil
ssqgesvwlhlpliahlvafnrkifpavtyaqsivstypsgsmgylicaknanrdvttpa
rtltaeqikalnlrfynsevhkaafvlpqfvknale

SCOPe Domain Coordinates for d2b2cb_:

Click to download the PDB-style file with coordinates for d2b2cb_.
(The format of our PDB-style files is described here.)

Timeline for d2b2cb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2b2ca1