Lineage for d2b2ca1 (2b2c A:3-314)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129722Family c.66.1.17: Spermidine synthase [69557] (3 protein domains)
    contains additional N-terminal tetramerisation all-beta domain, res. 1-71
  6. 2129727Protein Spermidine synthase [69558] (6 species)
    polyamine aminopropyltransferase
  7. 2129744Species Nematode (Caenorhabditis elegans) [TaxId:6239] [142589] (1 PDB entry)
    Uniprot Q9U2F0 3-314
  8. 2129745Domain d2b2ca1: 2b2c A:3-314 [127706]
    Other proteins in same PDB: d2b2cb_

Details for d2b2ca1

PDB Entry: 2b2c (more details), 2.5 Å

PDB Description: cloning, expression, characterisation and three- dimensional structure determination of the caenorhabditis elegans spermidine synthase
PDB Compounds: (A:) spermidine synthase

SCOPe Domain Sequences for d2b2ca1:

Sequence, based on SEQRES records: (download)

>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
klhkgwftefspddlekmngasdeeptkvlksdgqemggawpgqafslqvkkvlfheksk
yqdvlvfesttygnvlvldgivqaterdefsyqemlahlpmfahpdpkrvliigggdggi
lrevlkhesvekvtmceidemvidvakkflpgmscgfshpkldlfcgdgfeflknhknef
dviitdssdpvgpaeslfgqsyyellrdalkedgilssqgesvwlhlpliahlvafnrki
fpavtyaqsivstypsgsmgylicaknanrdvttpartltaeqikalnlrfynsevhkaa
fvlpqfvknale

Sequence, based on observed residues (ATOM records): (download)

>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
klhkgwftefspddlgawpgqafslqvkkvlfhekskyqdvlvfesttygnvlvldgivq
aterdefsyqemlahlpmfahpdpkrvliigggdggilrevlkhesvekvtmceidemvi
dvakkflpgmscgfshpkldlfcgdgfeflknhknefdviitdssyyellrdalkedgil
ssqgesvwlhlpliahlvafnrkifpavtyaqsivstypsgsmgylicaknanrdvttpa
rtltaeqikalnlrfynsevhkaafvlpqfvknale

SCOPe Domain Coordinates for d2b2ca1:

Click to download the PDB-style file with coordinates for d2b2ca1.
(The format of our PDB-style files is described here.)

Timeline for d2b2ca1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2b2cb_