Lineage for d2b2cb1 (2b2c B:3-314)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 704539Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 704540Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families) (S)
  5. 704785Family c.66.1.17: Spermidine synthase [69557] (2 proteins)
    contains additional N-terminal tetramerisation all-beta domain, res. 1-71
  6. 704790Protein Spermidine synthase [69558] (6 species)
    polyamine aminopropyltransferase
  7. 704796Species Caenorhabditis elegans [TaxId:6239] [142589] (1 PDB entry)
  8. 704798Domain d2b2cb1: 2b2c B:3-314 [127707]
    automatically matched to 2B2C A:3-314

Details for d2b2cb1

PDB Entry: 2b2c (more details), 2.5 Å

PDB Description: cloning, expression, characterisation and three- dimensional structure determination of the caenorhabditis elegans spermidine synthase
PDB Compounds: (B:) spermidine synthase

SCOP Domain Sequences for d2b2cb1:

Sequence, based on SEQRES records: (download)

>d2b2cb1 c.66.1.17 (B:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]}
klhkgwftefspddlekmngasdeeptkvlksdgqemggawpgqafslqvkkvlfheksk
yqdvlvfesttygnvlvldgivqaterdefsyqemlahlpmfahpdpkrvliigggdggi
lrevlkhesvekvtmceidemvidvakkflpgmscgfshpkldlfcgdgfeflknhknef
dviitdssdpvgpaeslfgqsyyellrdalkedgilssqgesvwlhlpliahlvafnrki
fpavtyaqsivstypsgsmgylicaknanrdvttpartltaeqikalnlrfynsevhkaa
fvlpqfvknale

Sequence, based on observed residues (ATOM records): (download)

>d2b2cb1 c.66.1.17 (B:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]}
klhkgwftefspddlgawpgqafslqvkkvlfhekskyqdvlvfesttygnvlvldgivq
aterdefsyqemlahlpmfahpdpkrvliigggdggilrevlkhesvekvtmceidemvi
dvakkflpgmscgfshpkldlfcgdgfeflknhknefdviitdssyyellrdalkedgil
ssqgesvwlhlpliahlvafnrkifpavtyaqsivstypsgsmgylicaknanrdvttpa
rtltaeqikalnlrfynsevhkaafvlpqfvknale

SCOP Domain Coordinates for d2b2cb1:

Click to download the PDB-style file with coordinates for d2b2cb1.
(The format of our PDB-style files is described here.)

Timeline for d2b2cb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2b2ca1