SCOPe 2.08: Domain d2ayba1: 2ayb A:281-366

Lineage for d2ayba1 (2ayb A:281-366)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family)

5. Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins)

6. Protein Papillomavirus-1 E2 protein [54959] (5 species)
   forms dimers with subunit beta-sheets making (8,12) barrel

7. Species Human papillomavirus type 6a [TaxId:37122] [102990] (4 PDB entries)

8. Domain d2ayba1: 2ayb A:281-366 [127544]
   automatically matched to d1r8ha_
   protein/DNA complex

Details for d2ayba1

PDB Entry: 2ayb, 3.2 Å

PDB Description: crystal structure of hpv6a e2 dna binding domain bound to a 16 base pair dna target

PDB Compounds: (A:) Regulatory protein E2

SCOPe Domain Sequences for d2ayba1:

Sequence; same for both SEQRES and ATOM records:

>d2ayba1 d.58.8.1 (A:281-366) Papillomavirus-1 E2 protein {Human papillomavirus type 6a [TaxId: 37122]}
ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhsee
qrqqflnvvkipptirhklgfmsmhll

Timeline for d2ayba1:

• d2ayba1 first appeared in SCOP 1.73
  
• d2ayba1 appears in SCOPe 2.07