Lineage for d1r8ha_ (1r8h A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952704Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) (S)
  5. 2952705Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins)
  6. 2952726Protein Papillomavirus-1 E2 protein [54959] (5 species)
    forms dimers with subunit beta-sheets making (8,12) barrel
  7. 2952757Species Human papillomavirus type 6a [TaxId:37122] [102990] (4 PDB entries)
  8. 2952758Domain d1r8ha_: 1r8h A: [97233]
    complexed with po4

Details for d1r8ha_

PDB Entry: 1r8h (more details), 1.9 Å

PDB Description: Comparison of the structure and DNA binding properties of the E2 proteins from an oncogenic and a non-oncogenic human papillomavirus
PDB Compounds: (A:) Regulatory protein E2

SCOPe Domain Sequences for d1r8ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r8ha_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Human papillomavirus type 6a [TaxId: 37122]}
ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhsee
qrqqflnvvkipptirhklgfmsmhll

SCOPe Domain Coordinates for d1r8ha_:

Click to download the PDB-style file with coordinates for d1r8ha_.
(The format of our PDB-style files is described here.)

Timeline for d1r8ha_: