PDB entry 1r8h

View 1r8h on RCSB PDB site
Description: Comparison of the structure and DNA binding properties of the E2 proteins from an oncogenic and a non-oncogenic human papillomavirus
Class: transcription, replication
Keywords: Anti-parallel beta-barrel, DNA-binding domain, TRANSCRIPTION, REPLICATION
Deposited on 2003-10-24, released 2003-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.195
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulatory protein E2
    Species: Human papillomavirus - 6 [TaxId:37122]
    Gene: E2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84294 (0-86)
      • see remark 999 (83)
    Domains in SCOPe 2.07: d1r8ha_
  • Chain 'B':
    Compound: Regulatory protein E2
    Species: Human papillomavirus - 6 [TaxId:37122]
    Gene: E2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84294 (0-86)
      • see remark 999 (83)
    Domains in SCOPe 2.07: d1r8hb_
  • Chain 'C':
    Compound: Regulatory protein E2
    Species: Human papillomavirus - 6 [TaxId:37122]
    Gene: E2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84294 (0-86)
      • see remark 999 (83)
    Domains in SCOPe 2.07: d1r8hc_
  • Chain 'D':
    Compound: Regulatory protein E2
    Species: Human papillomavirus - 6 [TaxId:37122]
    Gene: E2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84294 (0-86)
      • see remark 999 (83)
    Domains in SCOPe 2.07: d1r8hd_
  • Chain 'E':
    Compound: Regulatory protein E2
    Species: Human papillomavirus - 6 [TaxId:37122]
    Gene: E2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84294 (0-86)
      • see remark 999 (83)
    Domains in SCOPe 2.07: d1r8he_
  • Chain 'F':
    Compound: Regulatory protein E2
    Species: Human papillomavirus - 6 [TaxId:37122]
    Gene: E2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84294 (0-86)
      • see remark 999 (83)
    Domains in SCOPe 2.07: d1r8hf_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r8hA (A:)
    ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhsee
    qrqqflnvvkipptirhklgfmsmhll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r8hB (B:)
    ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhsee
    qrqqflnvvkipptirhklgfmsmhll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1r8hC (C:)
    ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhsee
    qrqqflnvvkipptirhklgfmsmhll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r8hC (C:)
    ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkhaivtvtyhseeqrqq
    flnvvkipptirhklgfmsmhll
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r8hD (D:)
    ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhsee
    qrqqflnvvkipptirhklgfmsmhll
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r8hE (E:)
    ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhsee
    qrqqflnvvkipptirhklgfmsmhll
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1r8hF (F:)
    ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhsee
    qrqqflnvvkipptirhklgfmsmhll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r8hF (F:)
    ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkhaivtvtyhseeqrqq
    flnvvkipptirhklgfmsmhll