![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) ![]() |
![]() | Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins) |
![]() | Protein Papillomavirus-1 E2 protein [54959] (5 species) forms dimers with subunit beta-sheets making (8,12) barrel |
![]() | Species Human papillomavirus type 6a [TaxId:37122] [102990] (4 PDB entries) |
![]() | Domain d2aybb1: 2ayb B:281-366 [127545] automatically matched to d1r8ha_ protein/DNA complex |
PDB Entry: 2ayb (more details), 3.2 Å
SCOPe Domain Sequences for d2aybb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aybb1 d.58.8.1 (B:281-366) Papillomavirus-1 E2 protein {Human papillomavirus type 6a [TaxId: 37122]} ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhsee qrqqflnvvkipptirhklgfmsmhll
Timeline for d2aybb1: