Class a: All alpha proteins [46456] (284 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (8 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins) |
Protein Cytochrome c550 [100991] (1 species) |
Species Thermosynechococcus elongatus [TaxId:146786] [100992] (2 PDB entries) |
Domain d2axtv1: 2axt V:27-157 [127499] Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtz1 automatically matched to d1mz4a_ complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd |
PDB Entry: 2axt (more details), 3 Å
SCOP Domain Sequences for d2axtv1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2axtv1 a.3.1.1 (V:27-157) Cytochrome c550 {Thermosynechococcus elongatus [TaxId: 146786]} aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil vepkilgdkwg
Timeline for d2axtv1: