| Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
| Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (1 family) ![]() |
| Family f.23.36.1: PsbK-like [161038] (1 protein) Pfam PF02533 |
| Protein Photosystem II reaction center protein K, PsbK [161039] (1 species) |
| Species Thermosynechococcus elongatus [TaxId:146786] [161040] (1 PDB entry) Uniprot Q9F1K9 10-46 |
| Domain d2axtk1: 2axt K:10-46 [144935] Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv1, d2axtz1 complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd |
| PDB Entry: 2axt (more details) PDB Description: crystal structure of photosystem ii from thermosynechococcus
PDB Compounds: (K:) Photosystem II reaction center protein KSCOP Domain Sequences for d2axtk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2axtk1 f.23.36.1 (K:10-46) Photosystem II reaction center protein K, PsbK {Thermosynechococcus elongatus [TaxId: 146786]}
klpeayaifdplvdvlpvipvlflalafvwqaavgfr
SCOP Domain Coordinates for d2axtk1:
Click to download the PDB-style file with coordinates for d2axtk1. (The format of our PDB-style files is described here.)
Timeline for d2axtk1:
d2axtk1 is new in SCOP 1.75 | d2axtk1 (click for larger image) d2axtk1 in context of chain d2axtk1 in context of PDB Domains from other chains: d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv1, d2axtz1 |
|
|
Copyright © 1994-2013 The SCOP
and Astral authors scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu |