Domain d2axtk1: 2axt K:10-46

Structural Classification of Proteins and ASTRAL release 1.75 (June 2009)

Lineage for d2axtk1 (2axt K:10-46)

Root: SCOP 1.75
Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
not a true fold
Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (1 family)
Family f.23.36.1: PsbK-like [161038] (1 protein)
Pfam PF02533
Protein Photosystem II reaction center protein K, PsbK [161039] (1 species)
Species Thermosynechococcus elongatus [TaxId:146786] [161040] (1 PDB entry)
Uniprot Q9F1K9 10-46

Domain d2axtk1: 2axt K:10-46 [144935]
Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv1, d2axtz1
complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd

PDB Entry: 2axt (more details)
PDB Description: crystal structure of photosystem ii from thermosynechococcus
PDB Compounds: (K:) Photosystem II reaction center protein K

SCOP Domain Sequences for d2axtk1:
Sequence; same for both SEQRES and ATOM records: (download)

>d2axtk1 f.23.36.1 (K:10-46) Photosystem II reaction center protein K, PsbK {Thermosynechococcus elongatus [TaxId: 146786]} klpeayaifdplvdvlpvipvlflalafvwqaavgfr

SCOP Domain Coordinates for d2axtk1:

Click to download the PDB-style file with coordinates for d2axtk1.
(The format of our PDB-style files is described here.)

Timeline for d2axtk1:
d2axtk1 is new in SCOP 1.75
d2axtk1 appears in SCOP 1.75A

d2axtk1
(click for larger image)

d2axtk1 in context of chain

d2axtk1 in context of PDB
Domains from other chains:
d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv1, d2axtz1