Lineage for d2axta1 (2axt A:10-344)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887887Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 887888Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. 887889Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (4 proteins)
    L and M are probably related to each other
  6. 888073Protein Photosystem Q(B) protein 1, PsbA1 [161053] (1 species)
  7. 888074Species Thermosynechococcus elongatus [TaxId:146786] [161054] (1 PDB entry)
    Uniprot P0A445 10-344
  8. 888075Domain d2axta1: 2axt A:10-344 [144926]
    Other proteins in same PDB: d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv1, d2axtz1
    complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd

Details for d2axta1

PDB Entry: 2axt (more details), 3 Å

PDB Description: crystal structure of photosystem ii from thermosynechococcus elongatus
PDB Compounds: (A:) Photosystem Q(B) protein

SCOP Domain Sequences for d2axta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axta1 f.26.1.1 (A:10-344) Photosystem Q(B) protein 1, PsbA1 {Thermosynechococcus elongatus [TaxId: 146786]}
sanlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepvsg
sllygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascymgr
qwelsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfqae
hnilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfgqeeetyniv
aahgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngfnfnhsvida
kgnvintwadiinranlgmevmhernahnfpldla

SCOP Domain Coordinates for d2axta1:

Click to download the PDB-style file with coordinates for d2axta1.
(The format of our PDB-style files is described here.)

Timeline for d2axta1: