Lineage for d2axtv1 (2axt V:27-157)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 904708Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 904709Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 904710Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 904765Protein Cytochrome c550 [100991] (1 species)
  7. 904766Species Thermosynechococcus elongatus [TaxId:146786] [100992] (2 PDB entries)
  8. 904768Domain d2axtv1: 2axt V:27-157 [127499]
    Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtz1
    automatically matched to d1mz4a_
    complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd, unk

Details for d2axtv1

PDB Entry: 2axt (more details), 3 Å

PDB Description: crystal structure of photosystem ii from thermosynechococcus elongatus
PDB Compounds: (V:) cytochrome c-550

SCOPe Domain Sequences for d2axtv1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axtv1 a.3.1.1 (V:27-157) Cytochrome c550 {Thermosynechococcus elongatus [TaxId: 146786]}
aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla
latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil
vepkilgdkwg

SCOPe Domain Coordinates for d2axtv1:

Click to download the PDB-style file with coordinates for d2axtv1.
(The format of our PDB-style files is described here.)

Timeline for d2axtv1: