SCOPe 2.01: Domain d2axtf1: 2axt F:11-45

Lineage for d2axtf1 (2axt F:11-45)

1. Root: SCOPe 2.01

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family)

5. Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
   Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284

6. Protein Cytochrome b559 subunit beta, PsbF [161049] (1 species)

7. Species Thermosynechococcus elongatus [TaxId:146786] [161050] (1 PDB entry)
   Uniprot Q8DIN9 11-45

8. Domain d2axtf1: 2axt F:11-45 [144931]
   Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axth1, d2axti1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv1, d2axtz1
   complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd, unk

Details for d2axtf1

PDB Entry: 2axt, 3 Å

PDB Description: crystal structure of photosystem ii from thermosynechococcus elongatus

PDB Compounds: (F:) cytochrome b559 beta subunit

SCOPe Domain Sequences for d2axtf1:

Sequence; same for both SEQRES and ATOM records:

>d2axtf1 f.23.38.1 (F:11-45) Cytochrome b559 subunit beta, PsbF {Thermosynechococcus elongatus [TaxId: 146786]}
vsypiftvrwvavhtlavptifflgaiaamqfiqr

Timeline for d2axtf1:

• d2axtf1 first appeared in SCOP 1.75
  
• d2axtf1 appears in SCOPe 2.02
  
• d2axtf1 appears in the current release, SCOPe 2.08