Lineage for d2axtt1 (2axt T:1-30)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887128Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 887760Superfamily f.23.34: Photosystem II reaction center protein T, PsbT [161029] (1 family) (S)
  5. 887761Family f.23.34.1: PsbT-like [161030] (1 protein)
    Pfam PF01405
  6. 887762Protein Photosystem II reaction center protein T, PsbT [161031] (1 species)
  7. 887763Species Thermosynechococcus elongatus [TaxId:146786] [161032] (1 PDB entry)
    Uniprot Q8DIQ0 1-30
  8. 887764Domain d2axtt1: 2axt T:1-30 [144939]
    Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtu1, d2axtv1, d2axtz1
    complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd

Details for d2axtt1

PDB Entry: 2axt (more details), 3 Å

PDB Description: crystal structure of photosystem ii from thermosynechococcus elongatus
PDB Compounds: (T:) Photosystem II reaction center T protein

SCOP Domain Sequences for d2axtt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axtt1 f.23.34.1 (T:1-30) Photosystem II reaction center protein T, PsbT {Thermosynechococcus elongatus [TaxId: 146786]}
metityvfifaciialfffaiffrepprit

SCOP Domain Coordinates for d2axtt1:

Click to download the PDB-style file with coordinates for d2axtt1.
(The format of our PDB-style files is described here.)

Timeline for d2axtt1: