Lineage for d2atpc_ (2atp C:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 929433Protein CD8 [48734] (3 species)
  7. 929442Species Mouse (Mus musculus) [TaxId:10090] [48736] (5 PDB entries)
  8. 929446Domain d2atpc_: 2atp C: [127302]
    automated match to d1bqhh_
    complexed with nag

Details for d2atpc_

PDB Entry: 2atp (more details), 2.4 Å

PDB Description: crystal structure of a cd8ab heterodimer
PDB Compounds: (C:) T-cell surface glycoprotein CD8 alpha chain

SCOPe Domain Sequences for d2atpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2atpc_ b.1.1.1 (C:) CD8 {Mouse (Mus musculus) [TaxId: 10090]}
apelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnki
twdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqkv

SCOPe Domain Coordinates for d2atpc_:

Click to download the PDB-style file with coordinates for d2atpc_.
(The format of our PDB-style files is described here.)

Timeline for d2atpc_: