SCOP 1.73: Domain d2atpc1: 2atp C:4-121

Lineage for d2atpc1 (2atp C:4-121)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein CD8 [48734] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [48736] (4 PDB entries)

8. Domain d2atpc1: 2atp C:4-121 [127302]
   automatically matched to d1bqhh_
   complexed with nag

Details for d2atpc1

PDB Entry: 2atp, 2.4 Å

PDB Description: crystal structure of a cd8ab heterodimer

PDB Compounds: (C:) T-cell surface glycoprotein CD8 alpha chain

SCOP Domain Sequences for d2atpc1:

Sequence; same for both SEQRES and ATOM records:

>d2atpc1 b.1.1.1 (C:4-121) CD8 {Mouse (Mus musculus) [TaxId: 10090]}
apelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnki
twdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqk

Timeline for d2atpc1:

• d2atpc1 is new in SCOP 1.73
  
• d2atpc1 appears in SCOP 1.75
  
• d2atpc1 appears in the current release, SCOPe 2.08, called d2atpc_