Lineage for d2atpc1 (2atp C:4-121)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 781680Protein CD8 [48734] (3 species)
  7. 781685Species Mouse (Mus musculus) [TaxId:10090] [48736] (4 PDB entries)
  8. 781689Domain d2atpc1: 2atp C:4-121 [127302]
    automatically matched to d1bqhh_
    complexed with nag

Details for d2atpc1

PDB Entry: 2atp (more details), 2.4 Å

PDB Description: crystal structure of a cd8ab heterodimer
PDB Compounds: (C:) T-cell surface glycoprotein CD8 alpha chain

SCOP Domain Sequences for d2atpc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2atpc1 b.1.1.1 (C:4-121) CD8 {Mouse (Mus musculus) [TaxId: 10090]}
apelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnki
twdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqk

SCOP Domain Coordinates for d2atpc1:

Click to download the PDB-style file with coordinates for d2atpc1.
(The format of our PDB-style files is described here.)

Timeline for d2atpc1: