Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein CD8 [48734] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [48736] (5 PDB entries) |
Domain d2atpa_: 2atp A: [127301] automated match to d1bqhh_ complexed with nag |
PDB Entry: 2atp (more details), 2.4 Å
SCOPe Domain Sequences for d2atpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2atpa_ b.1.1.1 (A:) CD8 {Mouse (Mus musculus) [TaxId: 10090]} apelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnki twdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqk
Timeline for d2atpa_: