SCOP 1.75: Domain d2atpa1: 2atp A:4-121

Lineage for d2atpa1 (2atp A:4-121)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein CD8 [48734] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [48736] (4 PDB entries)

8. Domain d2atpa1: 2atp A:4-121 [127301]
   automatically matched to d1bqhh_
   complexed with nag

Details for d2atpa1

PDB Entry: 2atp, 2.4 Å

PDB Description: crystal structure of a cd8ab heterodimer

PDB Compounds: (A:) T-cell surface glycoprotein CD8 alpha chain

SCOP Domain Sequences for d2atpa1:

Sequence; same for both SEQRES and ATOM records:

>d2atpa1 b.1.1.1 (A:4-121) CD8 {Mouse (Mus musculus) [TaxId: 10090]}
apelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnki
twdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqk

Timeline for d2atpa1:

• d2atpa1 first appeared in SCOP 1.73
  
• d2atpa1 is called d2atpa_ in SCOPe 2.01
  
• d2atpa1 appears in the current release, SCOPe 2.08, called d2atpa_