Lineage for d2atpa1 (2atp A:4-121)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652103Protein CD8 [48734] (2 species)
  7. 652108Species Mouse (Mus musculus) [TaxId:10090] [48736] (4 PDB entries)
  8. 652111Domain d2atpa1: 2atp A:4-121 [127301]
    automatically matched to d1bqhh_
    complexed with nag

Details for d2atpa1

PDB Entry: 2atp (more details), 2.4 Å

PDB Description: crystal structure of a cd8ab heterodimer
PDB Compounds: (A:) T-cell surface glycoprotein CD8 alpha chain

SCOP Domain Sequences for d2atpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2atpa1 b.1.1.1 (A:4-121) CD8 {Mouse (Mus musculus) [TaxId: 10090]}
apelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnki
twdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqk

SCOP Domain Coordinates for d2atpa1:

Click to download the PDB-style file with coordinates for d2atpa1.
(The format of our PDB-style files is described here.)

Timeline for d2atpa1: